PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10010005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 155aa    MW: 17422.5 Da    PI: 4.9014
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10010005genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.27.3e-132987563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                 ++ +r+++NRe+ArrsR RK++++e L  +  +L++eN++ +k++e   + + +++s +
  Lus10010005 29 RKRKRMISNRESARRSRMRKQKQVEDLVSETSQLQKENEQIRKQVEVSGQRYMEMESAN 87
                 6789****************************************999888888887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-162589IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-112674No hitNo description
PROSITE profilePS5021711.1972774IPR004827Basic-leucine zipper domain
PfamPF001702.2E-112987IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.94E-112983No hitNo description
CDDcd147021.30E-163081No hitNo description
PROSITE patternPS0003603247IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MSGSASSQRQ PASSGSDTDP RYASVTDERK RKRMISNRES ARRSRMRKQK QVEDLVSETS  60
QLQKENEQIR KQVEVSGQRY MEMESANNVL KAQAMELTDR LRSLNSVLEI VEAVSGLDVD  120
IPEMPDDRLF EPWVSVQQQP IMASVASAGD VLEY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12849RKRKRMISNRESARRSRMRKQK
24148RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8302154e-47EU830215.1 Linum usitatissimum clone LU0009F03 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051102.13e-62Basic region/leucine zipper motif 53
SwissprotQ9LZP87e-53BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A061DR453e-62A0A061DR45_THECC; Basic region/leucine zipper motif 53
STRINGPOPTR_0014s11590.16e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42023460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.14e-54basic region/leucine zipper motif 53